PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM08G10180.4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family HD-ZIP
Protein Properties Length: 522aa    MW: 57708.5 Da    PI: 9.1687
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM08G10180.4genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox61.61.2e-19115170257
                      T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
         Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                      r+ + +t +q e+L+++F+++++p++++ ++LAk+l++te+q+k+WFqN R+k+kk
  OGLUM08G10180.4 115 RRYQLLTMQQKETLNRAFQSCPNPDRNDLKKLAKELNMTETQIKYWFQNCRTKMKK 170
                      5677899************************************************8 PP

2START70.25.8e-233215097164
                      HHHHHHHHHHC-TT-EEEE.....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEEEEEEC CS
            START   7 aqelvkkalaeepgWvkss.....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....kaetlevis 86 
                      ++e++ k +++ p+W         es+n++e+l k  +  +     +++ + r++++v + +++lv++lld + +W e ++    +a t++ is
  OGLUM08G10180.4 321 ENESLVKKKENGPLWLPHMdilgvESLNYQEYLAKSRTI-GqkpvdFKVVVTRDTAIVNGSCVDLVKSLLDAN-RWRELFPgivaSANTTKIIS 412
                      5666777788999999888899999********999553.3589999**************************.******99999********* PP

                      TT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--..........-TTSEE...-EESSEEEEEEEECTCE CS
            START  87 sg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppe.........sssvvR...aellpSgiliepksngh 161
                      +g      g lqlm aelq++sp vp  d++f+R++ q g g w +vd S+d   + ++         ss  +R   ++llpSg++ie+++ng+
  OGLUM08G10180.4 413 TGlsnlhdGLLQLMRAELQVMSPEVPvCDVTFLRQSVQFGSGLWCVVDASIDTILPGESktaqsivqtSSTAARrmeVRLLPSGCVIEEMENGY 506
                      ***************************************************98777766653333443222223455899************** PP

                      EEE CS
            START 162 skv 164
                      skv
  OGLUM08G10180.4 507 SKV 509
                      **9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.1E-15101153IPR009057Homeodomain-like
SuperFamilySSF466895.01E-18103172IPR009057Homeodomain-like
PROSITE profilePS5007115.742111171IPR001356Homeobox domain
SMARTSM003891.9E-17113175IPR001356Homeobox domain
CDDcd000861.90E-17114170No hitNo description
PfamPF000462.4E-17115170IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.4E-4154196IPR009057Homeodomain-like
CDDcd146860.00187162199No hitNo description
PROSITE profilePS5084814.557297509IPR002913START domain
SuperFamilySSF559617.69E-14301513No hitNo description
CDDcd088752.74E-70301509No hitNo description
PfamPF018527.4E-16321509IPR002913START domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0008289Molecular Functionlipid binding
Sequence ? help Back to Top
Protein Sequence    Length: 522 aa     Download sequence    Send to blast
MGRPVAPRLG SPLSSPAAAH AAAGAPAPSR AARWGRGSPR PCAVLAIPLV EVMDGELKLM  60
ASYVSKLKFI LQKDQQQEPH TANLLVLLGS SNQDKRNGLS QGENRMDTCT RKKPRRYQLL  120
TMQQKETLNR AFQSCPNPDR NDLKKLAKEL NMTETQIKYW FQNCRTKMKK FKNNEERKLL  180
QKENEELKKE NAELRNRMKN STCRACDLPL FHIDCRHWEN PMLNKGNHGV TSNLIPQAVS  240
SLLPSSSGFV ASGSNLSSNA VLMPVSAMPS SVLQPAPAVS GANFPILHNL SANANDGYTE  300
KNVLLDLANR AMEEFFSLMK ENESLVKKKE NGPLWLPHMD ILGVESLNYQ EYLAKSRTIG  360
QKPVDFKVVV TRDTAIVNGS CVDLVKSLLD ANRWRELFPG IVASANTTKI ISTGLSNLHD  420
GLLQLMRAEL QVMSPEVPVC DVTFLRQSVQ FGSGLWCVVD ASIDTILPGE SKTAQSIVQT  480
SSTAARRMEV RLLPSGCVIE EMENGYSKVL CFLIDSITGT RC
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0737840.0AK073784.1 Oryza sativa Japonica Group cDNA clone:J033068E17, full insert sequence.
GenBankAK1004410.0AK100441.1 Oryza sativa Japonica Group cDNA clone:J023089M04, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015650917.10.0PREDICTED: homeobox-leucine zipper protein ROC6-like isoform X2
TrEMBLA0A0E0ATG90.0A0A0E0ATG9_9ORYZ; Uncharacterized protein
STRINGLOC_Os08g19590.10.0(Oryza sativa Japonica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.21e-47HD-ZIP family protein